Flickerdeck
Download Now

Explore

  • Free Tarot Reading
  • Yes or No Tarot
  • Daily Tarot Card
  • Card Meanings
  • Tarot Spreads
  • Birth Card Calculator
  • Deck Gallery
  • Oracle Decks
  • Lenormand Decks
  • Major Arcana

Learn

  • Learn About Tarot
  • How to Read Tarot
  • Oracle vs Tarot
  • What Are Oracle Cards
  • Tarot Birth Cards
  • How to Shuffle Tarot Cards

Resources

  • About Our Methodology
  • Flickerdeck App
  • Contact Us
© 2026 Flickerdeck. All rights reserved.·Privacy Policy·Terms of Service·
Deck Gallery
  1. Home
  2. /Deck Gallery
  3. /🔮 PomTastical Tarot: A Pawsitively Magical Deck!
🔮 PomTastical Tarot: A Pawsitively Magical Deck!

🔮 PomTastical Tarot: A Pawsitively Magical Deck!

by Laurie

Tarot78 cards· Last updated April 14, 2026
animalfantasywhimsicaldarkdigital
pomeraniandog-themedmysticaldetailed-artanimal-tarotmagical-realism

Theme: Pomeranian dogs in mystical tarot settings

Medium: digital

A unique tarot deck featuring Pomeranian dogs in a whimsical, mystical art style, reimagining traditional tarot archetypes. The deck is titled "Tarot of Mystic Pawsibilities" on its box.

About This Deck

The PomTastical Tarot, also known as "Tarot of Mystic Pawsibilities," is a 78-card tarot deck that reinterprets classic tarot imagery through the lens of Pomeranian dogs. Each card features highly detailed illustrations where Pomeranians embody the roles and symbolism of the Major and Minor Arcana, blending the charm of these fluffy companions with mystical and fantastical elements.

The artwork is characterized by its rich detail and vibrant, yet often dark, color palette. The Pomeranians are depicted with expressive faces and dynamic poses, integrated into elaborate scenes that evoke traditional tarot symbolism. For instance, the Strength card shows a Pomeranian atop a lion, surrounded by sunflowers, while the Wheel of Fortune features a circular motif with elemental colors and symbols, all within a lush, nature-inspired setting.

This deck offers a unique blend of cuteness and depth, making it suitable for both seasoned tarot readers and those new to the practice. The familiar structure of a 78-card tarot deck is maintained, allowing for intuitive readings while providing a fresh, engaging visual experience. The overall aesthetic is one of magical realism, where the ordinary world of pets meets the extraordinary realm of divination.

Artwork & Design

The artwork is digitally rendered with a high degree of detail, creating a painterly effect. The color palette is rich and varied, often featuring deep blues, greens, and browns, with pops of brighter colors like yellow and red, particularly in the floral elements. The Pomeranians are depicted with realistic fur textures and expressive features, often adorned with subtle mystical elements like glowing eyes or ethereal auras. The compositions are intricate, incorporating natural elements like flowers, trees, and celestial bodies, all framed by dark borders that enhance the dramatic feel. The style is consistent across the visible cards, maintaining a cohesive visual narrative.

Key Features

  • 78-card tarot deck featuring Pomeranian dogs
  • Detailed, digitally rendered artwork with a mystical aesthetic
  • Reimagines traditional tarot archetypes with animal characters
  • Rich color palette and intricate compositions
  • Box titled "Tarot of Mystic Pawsibilities"

Who It's For

This deck is ideal for tarot readers who appreciate animal-themed decks, particularly dog lovers and Pomeranian enthusiasts. It appeals to those who enjoy whimsical and mystical art styles with a touch of cuteness, but also value detailed and expressive illustrations. Both beginners and experienced readers can use this deck, as it appears to follow traditional tarot structures while offering a unique visual interpretation.

Frequently Asked Questions

How many cards are in the PomTastical Tarot deck?
The PomTastical Tarot is a standard 78-card tarot deck, comprising both the Major and Minor Arcana, each featuring unique illustrations of Pomeranian dogs.
What is the art style of the PomTastical Tarot?
The art style is a detailed digital rendering, creating a painterly and mystical aesthetic. It combines realistic depictions of Pomeranians with fantastical elements and rich, often dark, color palettes, incorporating natural and symbolic backgrounds.
Is the PomTastical Tarot suitable for beginners?
Yes, the PomTastical Tarot is suitable for beginners. While it features unique Pomeranian imagery, it maintains the traditional 78-card tarot structure, allowing new readers to learn the system with a visually engaging and charming deck.
Does the PomTastical Tarot follow traditional tarot symbolism?
Based on the visible cards like Strength and Wheel of Fortune, the deck appears to follow traditional tarot symbolism, reinterpreting the archetypes through Pomeranian characters and mystical settings while retaining recognizable elements.

Campaign Stats

Raised

$2.0K

Backers

31

Funded

132%

Launched

Feb 2025

Platform: Kickstarter

View Campaign

Similar Decks

Eternal Garden Tarot

Eternal Garden Tarot

by &Play

TarotdarkdreamyAvailable
Caminante Tarot

Caminante Tarot

by Olena Us

Tarotdarkhand-drawn
Elegy of Black Lichen Tarot

Elegy of Black Lichen Tarot

by Deck Chi

TarotdarkgothicAvailable
Firebird Tarot: A Slavic Folklore Deck

Firebird Tarot: A Slavic Folklore Deck

by Baroque Publishing

Tarotfantasyhand-drawnAvailable
Tarot After Dark - #humanart

Tarot After Dark - #humanart

by SkaavArt

Tarotdarkcolorful
Sefirot: the Gilded Legacy

Sefirot: the Gilded Legacy

by Causa Creations

TarotelegantcolorfulAvailable

Explore decks in Flickerdeck

Discover tarot & oracle decks, do readings, and build your collection.

Learn More